PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462915571
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 556aa    MW: 61905.2 Da    PI: 10.1609
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462915571genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B336.68e-12168254798
                .-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
         B3   7 psdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                p+d++k+  + +p +f++++  +++  +   ++  + +++W++k+  + +++ +++t+ W +Fvk ng+    +v+++++g++ f  +vkvf+
  462915571 168 PPDSTKK--MLIPPEFVQRYvPKENLDNAVAVVLGPLSKVWRIKV--EMNQSDVLFTDRWAQFVKFNGITKENVVLLRYEGNMVF--TVKVFE 254
                5666665..8**********733334556778899**********..999999********************************..999987 PP

2B350.53.8e-16326409186
                EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                ++++ +++++lk++ l lp  f++++g+ + + +tl+    s + W+v    +k+s +y+l +GW +F+++n LkegD ++F +++
  462915571 326 WVTKHINANTLKKH-LALPTVFCDAIGLRESCMITLKTSVNSAQYWQVHGVSCKNS-SYLLVRGWLRFCQENSLKEGDACTFNVVE 409
                56788999999999.**************99988888777999*******777776.7************************9765 PP

3B338.32.4e-12471541375
                EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT-- CS
         B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLk 75 
                 + +++++ +++ l+lp +f++++g+ k++++tl+   +s++sW+  +   k+s+ +  ++GWk+F+++n+Lk
  462915571 471 EKQMNNSTIENH-LSLPASFCQAIGIRKTCTVTLKTSLSSSKSWQACIHPYKNSS-HHAGAGWKRFCQENRLK 541
                455588888888.**************99988888777999****9994444443.66899**********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010190.01355134IPR003340B3 DNA binding domain
PROSITE profilePS508638.54361134IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.1E-872136IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.24E-1172136IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-16157258IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-16159258IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.08160256IPR003340B3 DNA binding domain
SMARTSM010194.5E-8163256IPR003340B3 DNA binding domain
CDDcd100171.24E-9166253No hitNo description
PfamPF023621.9E-9168254IPR003340B3 DNA binding domain
SuperFamilySSF1019363.53E-14322410IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.687325424IPR003340B3 DNA binding domain
SMARTSM010190.0022326419IPR003340B3 DNA binding domain
PfamPF023621.5E-12327410IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.2E-15327410IPR015300DNA-binding pseudobarrel domain
CDDcd100171.05E-9337405No hitNo description
PROSITE profilePS508638.769468556IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.9E-11470541IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.73E-10471541IPR015300DNA-binding pseudobarrel domain
PfamPF023623.0E-9472541IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MSSPTSGDHG AASRKQLWVL LPFSRSSLVS PTPSPSHRRL DSDPVVEAAD SGLAFITLQR  60
IPDELADDVG AGEALVVGPF SKVWPVEVGW DGDGALLGRG WPEFADAYGV GGGWLLVLRH  120
RGRGVLTVKA FDDSGCIREL GAPIPHAVEA TMGSNDAPRR PQFIGLLPPD STKKMLIPPE  180
FVQRYVPKEN LDNAVAVVLG PLSKVWRIKV EMNQSDVLFT DRWAQFVKFN GITKENVVLL  240
RYEGNMVFTV KVFEPNGCQR ESKPKDIRIQ QIPGIKKQQE APTHKCKSKS NWSRTKGQNK  300
PNESMASLTK ASLRRQCIYE IGPPSWVTKH INANTLKKHL ALPTVFCDAI GLRESCMITL  360
KTSVNSAQYW QVHGVSCKNS SYLLVRGWLR FCQENSLKEG DACTFNVVET INTKNIPKQQ  420
LNPSASSGKR KSKNMWPVTE RSMKIKGSLN SLNKASKKSC VYNIGPPAWV EKQMNNSTIE  480
NHLSLPASFC QAIGIRKTCT VTLKTSLSSS KSWQACIHPY KNSSHHAGAG WKRFCQENRL  540
KYIKEYYKLP ANKWLY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975298.11e-139PREDICTED: putative B3 domain-containing protein Os04g0347400 isoform X1
TrEMBLA0A0A9S1930.0A0A0A9S193_ARUDO; Uncharacterized protein
STRINGSi012530m1e-119(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24650.16e-14DNA binding;DNA binding;sequence-specific DNA binding transcription factors